PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB12G16480.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 989aa    MW: 108591 Da    PI: 5.0774
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB12G16480.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.81.2e-1855101148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+WT+eEd +l +av+ + g++Wk+Ia++++  Rt+ qc +rwqk+l
     OB12G16480.1  55 KGNWTPEEDAILSRAVQTYKGKNWKKIAECFP-DRTDVQCLHRWQKVL 101
                      79******************************.************986 PP

2Myb_DNA-binding59.95.4e-19107153148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+W++eEd+++v+ v++lG++ W+tIa+ ++ gR +kqc++rw+++l
     OB12G16480.1 107 KGPWSKEEDDIIVQMVNKLGPKKWSTIAQALP-GRIGKQCRERWHNHL 153
                      79******************************.*************97 PP

3Myb_DNA-binding47.25.1e-15159201145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      + +WT+eE+  l++a++++G++ W+   + ++ gRt++ +k++w+
     OB12G16480.1 159 KEAWTQEEEITLIHAHRMYGNK-WAELTKFLP-GRTDNAIKNHWN 201
                      579*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.56650101IPR017930Myb domain
SuperFamilySSF466891.44E-1953116IPR009057Homeodomain-like
SMARTSM007173.5E-1754103IPR001005SANT/Myb domain
PfamPF002491.6E-1655101IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.4E-2457118IPR009057Homeodomain-like
CDDcd001679.33E-1557101No hitNo description
PROSITE profilePS5129431.404102157IPR017930Myb domain
SuperFamilySSF466891.51E-30104200IPR009057Homeodomain-like
SMARTSM007172.2E-17106155IPR001005SANT/Myb domain
PfamPF002493.3E-17107153IPR001005SANT/Myb domain
CDDcd001675.08E-15109153No hitNo description
Gene3DG3DSA:1.10.10.608.4E-26119160IPR009057Homeodomain-like
SMARTSM007174.4E-14158206IPR001005SANT/Myb domain
PROSITE profilePS5129419.654158208IPR017930Myb domain
PfamPF002491.9E-13159202IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.1E-21161208IPR009057Homeodomain-like
CDDcd001677.05E-11161201No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 989 aa     Download sequence    Send to blast
MSSPVMASDT GKGPDKGGEA SGPPPAPQEG EISNEPQRRR PLNGRTTGPT RRSTKGNWTP  60
EEDAILSRAV QTYKGKNWKK IAECFPDRTD VQCLHRWQKV LNPELVKGPW SKEEDDIIVQ  120
MVNKLGPKKW STIAQALPGR IGKQCRERWH NHLNPGINKE AWTQEEEITL IHAHRMYGNK  180
WAELTKFLPG RTDNAIKNHW NSSVKKKVDS YISSGLLAQV SCLPLNECSA HCNSSPGMTQ  240
QSEDSGCYAV REVENSSGCS QSSLSKVSCS QVHNANVTLG CDLQVNASVD NNETHDSQSS  300
MGLEACYASV EAVASAIPEV HYHVSSCSFD PDQHLQEEFA HGLNLHMSID EMPSNSSFAD  360
NQTICSIEDH EKSMEPYDVA VEMPLAILPS GDSGAEQKLH FMSEDDFNSP NCLKSEIWQD  420
ISLQSLLSEP DTVGTDSFSR SNHQSDVYSS KADTEFLAPP YLLQTSNSSS VIEATYGKSL  480
QMSIPPSLIC SNDMTDAPSD AIPEPKEIPF SHVEMVTQSS SSSGDAEMFA NPCSSNDRHA  540
PSMMESIPEC GHQQATNVEE PEASIEREPS VTQSVTAPVE QKDEGALFYE PPRFPSMDVP  600
FVSCDLVTSG DLQEYSPLGI RQLMRSSMNI CTPVRLWGSP THDESPDILL KSAAKSFICT  660
PSILKKRHRD LISPIPDKRI EKKSGTEKYC GVSDMSSVGI QTSFINAAKD HAVITKSVLR  720
IEKLFSDENK ENLGNKIEQA KDGQSAGNEK HIDEQERGEQ RSATNIATTY GDLPDNLQPA  780
GILIEHNSND LVSPYNGKNA MNQKLNTNKE SSVVCKEGVP AKSKPTELIV EKSSPCINVD  840
YEYVNILADT PGIKRGLESP SAWKSPWFVD MQFQGSYFVS PADRTYDALG LVKQINVQTA  900
AALAEAREVL ASGGQSENRN SDKENMENRN TKKEPGATIL QAKIMAEGRI LDFNECTTPV  960
RSSDKKAGSN LGRSLSSPIP SSHLLKSFR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C4e-66552086159MYB PROTO-ONCOGENE PROTEIN
1h89_C4e-66552086159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ4300510.0AJ430051.1 Oryza sativa mRNA for transcription factor myb (myb3R1 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006663924.20.0PREDICTED: myb-related protein 3R-1-like isoform X2
TrEMBLJ3NCE00.0J3NCE0_ORYBR; Uncharacterized protein
STRINGOB12G16480.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24953879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11510.21e-104myb domain protein 3r-4